PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000205962
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 297aa    MW: 33125.8 Da    PI: 6.2607
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000205962genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-32114170258
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                    dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+vers+e+p++++itYeg H h
  MDP0000205962 114 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCSAKKQVERSSEEPDTLIITYEGLHLH 170
                    8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.9108173IPR003657WRKY domain
SuperFamilySSF1182901.44E-26111170IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-29111170IPR003657WRKY domain
SMARTSM007741.6E-35113172IPR003657WRKY domain
PfamPF031061.3E-25114170IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEEAMXATWS DGSEEELVRE LLDNESPFFV LPEESVQSRT TSAFGKEAIN GFIPNVYSGP  60
TIQDIETALS VTTGTVQPQE LSNARLSLXE RGLSKVEHKY ILKIKSCGNG IMADDGYKWR  120
KYGQKSIKNS PNPRSYYRCT NPRCSAKKQV ERSSEEPDTL IITYEGLHLH FAYPFFDFNN  180
QAQXSSPSMK KPKKKTSVPQ AEDHDREAQE SLRSVTPDPV RDLPPGPFPG RHQGXVEEER  240
SSQGLLQDMV PFMIRNPKPS SASSNSTCSS SRSSPTSPSS LSWVSSYFDV GINHNFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-211121701371WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369986.11e-172PREDICTED: probable WRKY transcription factor 49
TrEMBLM5W2Y41e-147M5W2Y4_PRUPE; Uncharacterized protein
STRINGVIT_08s0007g00570.t011e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.14e-50WRKY DNA-binding protein 49